PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009609295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 329aa    MW: 36968.5 Da    PI: 7.5861
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009609295.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85e-54231501128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++
  XP_009609295.1  23 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-DIIAEVDLYKFDPWELPAKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTA 116
                     79****************************.99***************99999****************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg+kt+W+mheyr+
  XP_009609295.1 117 gGNQKVGVKKALVFYGGKPPKGVKTNWIMHEYRI 150
                     77788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-6519185IPR003441NAC domain
PROSITE profilePS5100562.35723184IPR003441NAC domain
PfamPF023654.7E-2824150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MESTTDSSTG NPPLQPPPPQ PQLPPGFRFH PTDEELVVHY LKKKAASVPL PVDIIAEVDL  60
YKFDPWELPA KANFGEQEWY FFSPRDRKYP NGARPNRAAT SGYWKATGTD KPVLTAGGNQ  120
KVGVKKALVF YGGKPPKGVK TNWIMHEYRI TENKTNNKPP GCDIANRKGS LRLDDWVLCR  180
IYKKNNTQRP IDHHERDDMN DMMGSSIPTC IATSISPFEQ NMYEGIINNN TSNMINNNVG  240
SISSSVLPPK QPLPAGLYWN EDHNTSSPSA KRFLAENSLD DELNMNITRP DEQNSFLSQL  300
PQNQVLGSLS DGVVFRQPYN QVTGMNWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-761718711168NO APICAL MERISTEM PROTEIN
1ut4_B2e-761718711168NO APICAL MERISTEM PROTEIN
1ut7_A2e-761718711168NO APICAL MERISTEM PROTEIN
1ut7_B2e-761718711168NO APICAL MERISTEM PROTEIN
3swm_A2e-761718714171NAC domain-containing protein 19
3swm_B2e-761718714171NAC domain-containing protein 19
3swm_C2e-761718714171NAC domain-containing protein 19
3swm_D2e-761718714171NAC domain-containing protein 19
3swp_A2e-761718714171NAC domain-containing protein 19
3swp_B2e-761718714171NAC domain-containing protein 19
3swp_C2e-761718714171NAC domain-containing protein 19
3swp_D2e-761718714171NAC domain-containing protein 19
4dul_A2e-761718711168NAC domain-containing protein 19
4dul_B2e-761718711168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609295.10.0PREDICTED: NAC transcription factor 25-like
SwissprotQ9LD441e-113NAC56_ARATH; NAC transcription factor 56
TrEMBLM1CCC71e-154M1CCC7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000644281e-153(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-111NAC domain containing protein 2